MAPK4 Antibody - middle region : HRP

MAPK4 Antibody - middle region : HRP
SKU
AVIARP56433_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Mitogen-activated protein kinase 4 is a member of the mitogen-activated protein kinase family. Tyrosine kinase growth factor receptors activate mitogen-activated protein kinases which then translocate into the nucleus where it phosphorylates nuclear targe

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAPK4

Key Reference: Murtagh,J.J. (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (19), 6870-6875

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: DFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mitogen-activated protein kinase 4

Protein Size: 587

Purification: Affinity Purified
More Information
SKU AVIARP56433_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56433_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5596
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×