Mapk9 Antibody - N-terminal region : FITC

Mapk9 Antibody - N-terminal region : FITC
SKU
AVIARP57732_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Mapk9 responds to activation by environmental stress and pro-inflammatory cytokines by phosphorylating a number of transcription factors, primarily components of AP-1 such as c-Jun and ATF2 and thus regulates AP-1 transcriptional activity. In T-cells, JNK1 and JNK2 are required for polarized differentiation of T-helper cells into Th1 cells.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitogen-activated protein kinase 9

Protein Size: 381

Purification: Affinity Purified
More Information
SKU AVIARP57732_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57732_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26420
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×