MEAK7 Antibody - N-terminal region : Biotin

MEAK7 Antibody - N-terminal region : Biotin
SKU
AVIARP57503_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KIAA1609

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: MGNSRSRVGRSFCSQFLPEEQAEIDQLFDALSSDKNSPNVSSKSFSLKAL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TLD domain-containing protein 1

Protein Size: 456

Purification: Affinity Purified
More Information
SKU AVIARP57503_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57503_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57707
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×