MED14 Antibody - middle region : Biotin

MED14 Antibody - middle region : Biotin
SKU
AVIARP58139_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein contains a bipartite nuclear localization signal. This gene is known to escape chromosome X-inactivation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MED14

Molecular Weight: 160kDa

Peptide Sequence: Synthetic peptide located within the following region: AADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mediator of RNA polymerase II transcription subunit 14

Protein Size: 1454

Purification: Affinity Purified

Subunit: 14
More Information
SKU AVIARP58139_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58139_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rabbit
Clonality Polyclonal
Application Western Blotting, Chromatin Immunoprecipitation (ChIP)
Human Gene ID 9282
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×