MED16 Antibody - C-terminal region : FITC

MED16 Antibody - C-terminal region : FITC
SKU
AVIARP57927_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: THRAP5 is part of the human thyroid hormone receptor-associated protein (TRAP)-Mediator family which acts as a coactivator for a broad range of nuclear hormone receptors as well as other classes of transcriptional activators.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MED16

Key Reference: Sato,S., (2004) Mol. Cell 14 (5), 685-691

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: MSLLFRLLTKLWICCRDEGPASEPDEALVDECCLLPSQLLIPSLDWLPAS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mediator of RNA polymerase II transcription subunit 16

Protein Size: 877

Purification: Affinity Purified

Subunit: 16
More Information
SKU AVIARP57927_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57927_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10025
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×