MED16 Antibody - C-terminal region : HRP

MED16 Antibody - C-terminal region : HRP
SKU
AVIARP57927_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: THRAP5 is part of the human thyroid hormone receptor-associated protein (TRAP)-Mediator family which acts as a coactivator for a broad range of nuclear hormone receptors as well as other classes of transcriptional activators.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MED16

Key Reference: Sato,S., (2004) Mol. Cell 14 (5), 685-691

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: MSLLFRLLTKLWICCRDEGPASEPDEALVDECCLLPSQLLIPSLDWLPAS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mediator of RNA polymerase II transcription subunit 16

Protein Size: 877

Purification: Affinity Purified

Subunit: 16
More Information
SKU AVIARP57927_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57927_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10025
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×