MEFV antibody

MEFV antibody
SKU
GTX01088-100
Packaging Unit
100 μg
Manufacturer
GeneTex

Availability: loading...
Price is loading...
Application Note: WB: 0.1-0.5μg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.

Calculated MW: 86

Form: Liquid

Buffer (with preservative): 5mg BSA, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg Sodium azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Background: This gene encodes a protein, also known as pyrin or marenostrin, that is an important modulator of innate immunity. Mutations in this gene are associated with Mediterranean fever, a hereditary periodic fever syndrome. [provided by RefSeq, Jul 2008]

Uniprot ID: O15553

Antigen Species: Human

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MEFV(5-39aa PSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSR).

Purification: Purified by antigen-affinity chromatography

Conjugation: Unconjugated

Full Name: MEFV innate immuity regulator, pyrin
More Information
SKU GTX01088-100
Manufacturer GeneTex
Manufacturer SKU GTX01088-100
Package Unit 100 μg
Quantity Unit STK
Reactivity Human, Rat (Rattus)
Clonality Polyclonal
Application Western Blotting
Isotype IgG
Human Gene ID 4210
Host Rabbit
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF) Download