MEIOB Antibody - C-terminal region : Biotin

MEIOB Antibody - C-terminal region : Biotin
SKU
AVIARP55533_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MEIOB

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: ANILLNFIRENKETNVLDDEIDSYFKESINLSTIVDVYTVEQLKGKALKN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Meiosis-specific with OB domain-containing protein Ensembl ENSP00000390778 Ensembl ENSP00000314484

Protein Size: 471

Purification: Affinity Purified
More Information
SKU AVIARP55533_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55533_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Pig (Porcine), Rabbit, Dog (Canine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 254528
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×