METTL4 antibody

METTL4 antibody
SKU
GTX04574-100
Packaging Unit
100 μl
Manufacturer
GeneTex

Availability: loading...
Price is loading...
Calculated MW: 54

Form: Liquid

Buffer (with preservative): PBS, 2% sucrose, 0.09% Sodium Azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Background: Enables RNA methyltransferase activity and site-specific DNA-methyltransferase (adenine-specific) activity. Involved in nucleic acid metabolic process; regulation of RNA metabolic process; and regulation of mitochondrial DNA replication. Located in cytosol; mitochondrial matrix; and nucleus. [provided by Alliance of Genome Resources, Apr 2022]

Uniprot ID: Q8N3J2

Antigen Species: Human

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human Mettl4: SGEFVFPLDSLHKKPYECLVLGRVKEKTALALRNEAVRTPPVPDQRLIVS .

Purification: Purified by affinity chromatography

Conjugation: Unconjugated

Full Name: methyltransferase like 4
More Information
SKU GTX04574-100
Manufacturer GeneTex
Manufacturer SKU GTX04574-100
Package Unit 100 μl
Quantity Unit STK
Reactivity Rat (Rattus)
Clonality Polyclonal
Application Western Blotting
Isotype IgG
Human Gene ID 64863
Host Rabbit
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF)
×