MKLN1 Antibody - N-terminal region : HRP

MKLN1 Antibody - N-terminal region : HRP
SKU
AVIARP56737_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Muskelin is an intracellular protein that acts as a mediator of cell spreading and cytoskeletal responses to the extracellular matrix component thrombospondin I.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MKLN1

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: ADFWAYSVKENQWTCISRDTEKENGPSARSCHKMCIDIQRRQIYTLGRYL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Muskelin

Protein Size: 528

Purification: Affinity Purified
More Information
SKU AVIARP56737_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56737_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4289
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×