MLF1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: MLF1 is involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. It interferes with erythopoietin-induced erythroid terminal differentiation by preventing cells from exiting the cell cycle through suppression of CDKN1B/p27Kip1 levels. MLF1 suppresses RFWD2/COP1 activity via CSN3 which activates p53 and induces cell cycle arrest.It binds DNA and affects the expression of a number of genes so may function as a transcription factor in the nucleus.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MLF1

Key Reference: Li,Z.F., J. Neurol. Sci. 264 (1-2), 77-86 (2008)

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: GRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Myeloid leukemia factor 1

Protein Size: 268

Purification: Affinity Purified

• SKU: AVIARP53757_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53757_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4291
• Host: Rabbit
• Conjugate: Conjugated, HRP