MNAT1 Antibody - N-terminal region

MNAT1 Antibody - N-terminal region
SKU
AVIP100992_P050-25
Packaging Unit
25µl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Description of Target: The coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC 2.7.7.1) is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD.Cyclin-dependent kinases (CDKs), which play an essential role in cell cycle control of eukaryotic cells, are phosphorylated and thus activated by the CDK-activating kinase (CAK). CAK is a multisubunit protein that includes CDK7 (MIM 601955), cyclin H (CCNH; MIM 601953), and MAT1. MAT1 (for 'menage a trois-1') is involved in the assembly of the CAK complex.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-498 AA053721.1 1-498 499-1372 BC000820.1 489-1362 1373-1388 BU620200.1 1-16 c

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MNAT1

Key Reference: Li,Y., (2007) Lung Cancer 58 (2), 171-183

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: DDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Protein Name: CDK-activating kinase assembly factor MAT1

Protein Size: 309

Purification: Affinity Purified
More Information
SKU AVIP100992_P050-25
Manufacturer Aviva Systems Biology
Manufacturer SKU P100992_P050-25UL
Package Unit 25µl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4331
Host Rabbit
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF)
×