MNS1 Antibody - N-terminal region : HRP

MNS1 Antibody - N-terminal region : HRP
SKU
AVIARP57223_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein highly similar to the mouse meiosis-specific nuclear structural 1 protein. The mouse protein was shown to be expressed at the pachytene stage during spermatogenesis and may function as a nuclear skeletal protein to regulate nuclear morphology during meiosis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MNS1

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: EKLAMELAKLKHESLKDEKMRQQVRENSIELRELEKKLKAAYMNKERAAQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Meiosis-specific nuclear structural protein 1

Protein Size: 495

Purification: Affinity Purified
More Information
SKU AVIARP57223_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57223_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55329
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×