MOAP1 Antibody - C-terminal region : Biotin

MOAP1 Antibody - C-terminal region : Biotin
SKU
AVIARP57614_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene was identified by its interaction with apoptosis regulator BAX protein. This protein contains a Bcl-2 homology 3 (BH3)-like motif, which is required for the association with BAX. When overexpressed, this gene has been shown to mediate caspase-dependent apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MOAP1

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: LSAYVLRLEPLLQKLVQRGAIERDAVNQARLDQVIAGAVHKTIRRELNLP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 351

Purification: Affinity Purified
More Information
SKU AVIARP57614_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57614_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64112
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×