Mrpl48 Antibody - C-terminal region : Biotin

Mrpl48 Antibody - C-terminal region : Biotin
SKU
AVIARP56817_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Mrpl48

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: ISGLSATFAEIFLEILQINLPEGVRLSVREHTEEDFKGRFKARPELEELL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitochondrial ribosomal protein L48 (Predicted), isoform CRA_c EMBL EDM18332.1

Protein Size: 211

Purification: Affinity Purified
More Information
SKU AVIARP56817_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56817_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 293149
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×