MTMR14 Antibody - middle region : FITC

MTMR14 Antibody - middle region : FITC
SKU
AVIARP57637_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a myotubularin-related protein. The encoded protein is a phosphoinositide phosphatase that specifically dephosphorylates phosphatidylinositol 3,5-biphosphate and phosphatidylinositol 3-phosphate. Mutations in this gene are correlated with autosomal dominant centronuclear myopathy. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 18.


Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MTMR14

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: NFLKHITSEEFSALKTQRRKSLPARDGGFTLEDICMLRRKDRGSTTSLGS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Myotubularin-related protein 14

Protein Size: 650

Purification: Affinity Purified
More Information
SKU AVIARP57637_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57637_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64419
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×