Mut Antibody - N-terminal region : HRP

Mut Antibody - N-terminal region : HRP
SKU
AVIARP56080_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Mut is involved in the degradation of several amino acids, odd-chain fatty acids and cholesterol via propionyl-CoA to the tricarboxylic acid cycle.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Mut

Molecular Weight: 82kDa

Peptide Sequence: Synthetic peptide located within the following region: LAKKQLKGKNPEDLIWHTPEGISIKPLYSRADTLDLPEELPGVKPFTRGP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Methylmalonyl-CoA mutase, mitochondrial

Protein Size: 748

Purification: Affinity Purified
More Information
SKU AVIARP56080_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56080_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 17850
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×