MYBPH Antibody - N-terminal region : HRP

MYBPH Antibody - N-terminal region : HRP
SKU
AVIARP56598_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: MYBPH binds to myosin; probably involved in interaction with thick myofilaments in the A-band.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MYBPH

Key Reference: Welikson,R.E. J. Cell. Sci. 115 (PT 17), 3517-3526 (2002)

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Myosin-binding protein H

Protein Size: 477

Purification: Affinity Purified
More Information
SKU AVIARP56598_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56598_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4608
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×