Ndufv2 Antibody - C-terminal region : Biotin

Ndufv2 Antibody - C-terminal region : Biotin
SKU
AVIARP57510_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human Ndufv2

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: DNYYEDLTPKDIEEIIDELKAGKVPKPGPRSGRFCCEPAGGLTSLTEPPK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial

Protein Size: 248

Purification: Affinity Purified
More Information
SKU AVIARP57510_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57510_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 72900
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×