NIT1 Antibody - N-terminal region : FITC

NIT1 Antibody - N-terminal region : FITC
SKU
AVIARP56646_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NIT1 play a role in cell growth and apoptosis: loss of expression promotes cell growth and resistance to DNA damage stress. NIT1 has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells; this effect is additive to the tum

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NIT1

Key Reference: Semba,S., (2006) J. Biol. Chem. 281 (38), 28244-28253

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLAREC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nitrilase homolog 1

Protein Size: 327

Purification: Affinity Purified
More Information
SKU AVIARP56646_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56646_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4817
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×