NME4 Antibody - middle region : HRP

NME4 Antibody - middle region : HRP
SKU
AVIARP56611_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm2

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NME4

Key Reference: Martin,J., (2004) Nature 432 (7020), 988-994

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: VAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Nucleoside diphosphate kinase, mitochondrial

Protein Size: 187

Purification: Affinity Purified
More Information
SKU AVIARP56611_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56611_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4833
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×