NPM2 Antibody - N-terminal region : Biotin

NPM2 Antibody - N-terminal region : Biotin
SKU
AVIARP58311_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: NPM2 belongs to the nucleoplasmin family. It probably involved in sperm DNA decondensation during fertilization.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NPM2

Key Reference: Burns,K.H., (2003) Science 300 (5619), 633-636

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nucleoplasmin-2

Protein Size: 214

Purification: Affinity Purified
More Information
SKU AVIARP58311_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58311_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10361
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×