NPM2 Antibody - N-terminal region : FITC

NPM2 Antibody - N-terminal region : FITC
SKU
AVIARP58310_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NPM2 is a core histones chaperone involved in chromatin reprogramming, specially during fertilization and early embryonic development. It probably involved in sperm DNA decondensation during fertilization.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NPM2

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: MNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQLEGKQSCRLLLHTIC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nucleoplasmin-2

Protein Size: 214

Purification: Affinity Purified
More Information
SKU AVIARP58310_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58310_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10361
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×