NPM2 Antibody - N-terminal region : HRP

NPM2 Antibody - N-terminal region : HRP
SKU
AVIARP58311_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: NPM2 belongs to the nucleoplasmin family. It probably involved in sperm DNA decondensation during fertilization.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NPM2

Key Reference: Burns,K.H., (2003) Science 300 (5619), 633-636

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Nucleoplasmin-2

Protein Size: 214

Purification: Affinity Purified
More Information
SKU AVIARP58311_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58311_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10361
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×