NRBP1 Antibody - N-terminal region : Biotin

NRBP1 Antibody - N-terminal region : Biotin
SKU
AVIARP54949_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: NRBP1 may play a role in subcellular trafficking between the endoplasmic reticulum and Golgi apparatus through interactions with the Rho-type GTPases. Binding to the NS3 protein of dengue virus type 2 appears to subvert this activity into the alteration of the intracellular membrane structure associated with flaviviral replication.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NRBP1

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: DESEILEESPCGRWQKRREEVNQRNVPGIDSAYLAMDTEEGVEVVWNEVQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nuclear receptor-binding protein

Protein Size: 535

Purification: Affinity Purified
More Information
SKU AVIARP54949_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54949_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29959
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×