NT5M Antibody - N-terminal region : FITC

NT5M Antibody - N-terminal region : FITC
SKU
AVIARP57370_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NT5M

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 5'(3')-deoxyribonucleotidase, mitochondrial

Protein Size: 228

Purification: Affinity Purified
More Information
SKU AVIARP57370_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57370_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56953
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×