NUCB1 Antibody - C-terminal region

Description of Target: An extracellular calcium binding protein of the mineralized matrix of bone [Calnuc or RGD:620030]. Also useful as a Golgi marker in immunohistochemistry (1:100 dilution).

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat.

Key Reference: Wendel,M., et al., 1995, J. Biol. Chem. 270 (11), 6125-6133.

Molecular Weight: 54kDa.

Peptide Sequence: Synthetic peptide located within the following region: SQPDGQLQFRADTGDAPVPAPAGDQKDVPASEKKVPEQPPVLPQLDSQHL.

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Protein Name: Nucleobindin-1.

Protein Size: 459.

Purification: Protein A purified.

• SKU: AVIP101699_T100-25
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: P101699_T100-25
• Package Unit: 25µl
• Quantity Unit: STK
• Reactivity: Mouse (Murine), Rat (Rattus), Dog (Canine)
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Human Gene ID: 84595
• Host: Rabbit