NUCB1 Antibody - C-terminal region

NUCB1 Antibody - C-terminal region
SKU
AVIP102230_T100-25
Packaging Unit
25µl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Description of Target: Calnuc or NUCB1 belongs to the nucleobindin family. It is a major calcium-binding protein of the Golgi and is a good Golgi marker. It may be involved in calcium homeostasis. Calnuc also plays roles in regulation of levels of .-amyloid precursor protein (APP) and its proteolytic metabolites to further affect the patho/physiological functions of APP including Alzheimer's disease pathogenesis. Useful for immunohistochemistry and western blot.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NUCB1.

Key Reference: Lin, P., et al., approved publication in the Journal of Neurochemistry. See //www.blackwell-synergy.com/loi/jnc for details (doi: 10.1111/j.1471-4159.2006.04336.x).

Molecular Weight: 51kDa.

Peptide Sequence: Synthetic peptide located within the following region: PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL.

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Protein Name: Nucleobindin-1.

Protein Size: 461.

Purification: Protein A purified.

More Information
SKU AVIP102230_T100-25
Manufacturer Aviva Systems Biology
Manufacturer SKU P102230_T100-25
Green Labware No
Package Unit 25µl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4924
Host Rabbit
Product information (PDF)
×
MSDS (PDF)
×