NXPH4 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: NXPH4 may be signaling molecules that resemble neuropeptides and that act by binding to alpha-neurexins and possibly other receptors.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NXPH4

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: MRLLPEWFLLLFGPWLLRKAVSAQIPESGRPQYLGLRPAAAGAGAPGQQL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Neurexophilin-4

Protein Size: 308

Purification: Affinity Purified

• SKU: AVIARP53543_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53543_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 11247
• Host: Rabbit
• Conjugate: Conjugated, HRP