OAZ3 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Ornithine decarboxylase catalyzes the conversion of ornithine to putrescine in the first and apparently rate-limiting step in polyamine biosynthesis. The ornithine decarboxylase antizymes play a role in the regulation of polyamine synthesis by binding to and inhibiting ornithine decarboxylase. Antizyme expression is auto-regulated by polyamine-enhanced translational frameshifting. In contrast to antizymes 1 and 2, which are widely expressed throughout the body, the expression of this gene product (antizyme 3) is restricted to testis germ cells, and thus it is a possible candidate for heritable forms of human male infertility. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OAZ3

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: DRRLFLDIPYQALDQGNRESLTATLEYVEEKTNVDSVFVNFQNDRNDRGA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ornithine decarboxylase antizyme 3

Protein Size: 187

Purification: Affinity Purified

• SKU: AVIARP53713_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53713_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51686
• Host: Rabbit
• Conjugate: Conjugated, FITC