ONECUT2 Antibody - middle region : Biotin

ONECUT2 Antibody - middle region : Biotin
SKU
AVIARP57926_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ONECUT2 is a member of the transcription factors of the ONECUT class, whose prototype is hepatocyte nuclear factor (HNF)-6. The distribution of OC-2 mRNA in humans is tissue-restricted, the strongest expression being detected in the liver and skin. ONECUT

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ONECUT2

Key Reference: Chamberlain,P.P., (2007) J. Biol. Chem. 282 (38), 28117-28125

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: LQEPEFQRMSALRLAACKRKEQEPNKDRNNSQKKSRLVFTDLQRRTLFAI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: One cut domain family member 2

Protein Size: 504

Purification: Affinity Purified
More Information
SKU AVIARP57926_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57926_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 9480
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×