ORC4L Antibody - middle region : Biotin

ORC4L Antibody - middle region : Biotin
SKU
AVIARP57782_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ORC4L

Key Reference: Clarke,C.A. Biochem. J. 388 (PT 2), 705-712 (2005)

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: VLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Origin recognition complex subunit 4

Protein Size: 436

Purification: Affinity Purified

Subunit: 4
More Information
SKU AVIARP57782_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57782_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5000
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×