ORC4L Antibody - middle region : HRP

ORC4L Antibody - middle region : HRP
SKU
AVIARP57782_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ORC4L

Key Reference: Clarke,C.A. Biochem. J. 388 (PT 2), 705-712 (2005)

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: VLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Origin recognition complex subunit 4

Protein Size: 436

Purification: Affinity Purified

Subunit: 4
More Information
SKU AVIARP57782_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57782_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5000
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×