ORC6 Antibody - N-terminal region : Biotin

ORC6 Antibody - N-terminal region : Biotin
SKU
AVIARP55021_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. ORC6L is a subunit of the ORC complex. It has been shown that this protein and and ORC1L are loosely associated with the core complex consisting of ORC2L, -3L, -4L and -5L. Gene silencing studies with small interfering RNA demonstrated that this protein plays an essential role in coordinating chromosome replication and segregation with cytokinesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ORC6

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: KAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMKCPLDRAYLIKLS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Origin recognition complex subunit 6

Protein Size: 252

Purification: Affinity Purified
More Information
SKU AVIARP55021_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55021_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23594
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×