OTUB1 Antibody - middle region : HRP

OTUB1 Antibody - middle region : HRP
SKU
AVIARP57000_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OTUB1

Key Reference: Juris,S.J., (2006) FEBS Lett. 580 (1), 179-183

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: KIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ubiquitin thioesterase OTUB1

Protein Size: 271

Purification: Affinity Purified
More Information
SKU AVIARP57000_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57000_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55611
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×