PADI4 Antibody - middle region : Biotin

PADI4 Antibody - middle region : Biotin
SKU
AVIARP54888_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PADI4 is an enzyme responsible for the conversion of arginine residues to citrulline residues. This protein may play a role in granulocyte and macrophage development leading to inflammation and immune response.This gene is a member of a gene family which encodes enzymes responsible for the conversion of arginine residues to citrulline residues. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PADI4

Key Reference: Costenbader,K.H., (er) Arthritis Res. Ther. 10 (3), R52 (2008) In press

Molecular Weight: 74kDa

Peptide Sequence: Synthetic peptide located within the following region: TGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQAL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein-arginine deiminase type-4

Protein Size: 663

Purification: Affinity Purified
More Information
SKU AVIARP54888_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54888_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23569
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×