PAOX Antibody - C-terminal region : FITC

PAOX Antibody - C-terminal region : FITC
SKU
AVIARP53830_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PAOX belongs to the flavin monoamine oxidase family. PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion. It can also oxidize N(1)-acetylspermidine to putrescine. PAOX does not oxidize spermidine. It plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PAOX

Key Reference: Jarvinen,A., (2006) J. Biol. Chem. 281 (8), 4589-4595

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: VGSTGGDLDLLAQPLPADGAGAQLQILFAGEATHRTFYSTTHGALLSGWRE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peroxisomal N(1)-acetyl-spermine/spermidine oxidase

Protein Size: 511

Purification: Affinity Purified
More Information
SKU AVIARP53830_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53830_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 196743
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×