PAOX Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: PAOX belongs to the flavin monoamine oxidase family. PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion. It can also oxidize N(1)-acetylspermidine to putrescine. PAOX does not oxidize spermidine. It plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PAOX

Key Reference: Jarvinen,A., (2006) J. Biol. Chem. 281 (8), 4589-4595

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: RGSAVGMEGGRPPPQSVGPAGAAAQAQALAGPSLLCSTRVGGRLGPSFLL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Peroxisomal N(1)-acetyl-spermine/spermidine oxidase

Protein Size: 486

Purification: Affinity Purified

• SKU: AVIARP53848_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53848_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 196743
• Host: Rabbit
• Conjugate: Conjugated, HRP