PARP11 antibody

Application Note: WB: 0.2-1 μg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.

Calculated MW: 39

Positive Control: Human muscle

Form: Liquid

Buffer (with preservative): PBS, 2% Sucrose, 0.09% Sodium Azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Uniprot ID: Q9NR21

Antigen Species: Human

Immunogen: A synthetic peptide directed towards the middle region of human PARP11 : IKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKD

Purification: Purified by affinity chromatography

Conjugation: Unconjugated

Full Name: poly(ADP-ribose) polymerase family member 11

• SKU: GTX04915-100
• Manufacturer: GeneTex
• Manufacturer SKU: GTX04915-100
• Package Unit: 100 μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57097
• Host: Rabbit
• Conjugate: Unconjugated