PARVG Antibody - C-terminal region : Biotin

PARVG Antibody - C-terminal region : Biotin
SKU
AVIARP57610_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Members of the parvin family, including PARVG, are actin-binding proteins associated with focal contacts.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PARVG

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: LLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALELLKDEGLLSCPVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Gamma-parvin

Protein Size: 331

Purification: Affinity Purified
More Information
SKU AVIARP57610_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57610_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64098
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×