PCOLCE Antibody - middle region : Biotin

PCOLCE Antibody - middle region : Biotin
SKU
AVIARP56378_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PCOLCE binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCOLCE

Key Reference: Grgurevic,L., (2007) Int Orthop 31 (6), 743-751

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Procollagen C-endopeptidase enhancer 1

Protein Size: 449

Purification: Affinity Purified
More Information
SKU AVIARP56378_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56378_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5118
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×