Pde2a Antibody - N-terminal region : FITC

Pde2a Antibody - N-terminal region : FITC
SKU
AVIARP56379_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The activation of Pde2a induces decreased cAMP accumulation; It is involved in nitric oxide mediated signaling in cardiac fibroblasts.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 104kDa

Peptide Sequence: Synthetic peptide located within the following region: CRSQQYPAARPAEPRGQQVFLKPDEPPPQPCADSLQDALLSLGAVIDIAG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cGMP-dependent 3',5'-cyclic phosphodiesterase

Protein Size: 935

Purification: Affinity Purified
More Information
SKU AVIARP56379_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56379_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 81743
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×