PDHA2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2. It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDHA2

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial

Protein Size: 388

Purification: Affinity Purified

Subunit: alpha, testis-specific form, mitochondrial

• SKU: AVIARP53632_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53632_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5161
• Host: Rabbit
• Conjugate: Conjugated, Biotin