PDHA2 Antibody - N-terminal region : HRP

PDHA2 Antibody - N-terminal region : HRP
SKU
AVIARP53632_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2. It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDHA2

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial

Protein Size: 388

Purification: Affinity Purified

Subunit: alpha, testis-specific form, mitochondrial
More Information
SKU AVIARP53632_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53632_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5161
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×