PDP2 Antibody - middle region : Biotin

PDP2 Antibody - middle region : Biotin
SKU
AVIARP57452_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PDP2 catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDP2

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: LQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial

Protein Size: 529

Purification: Affinity Purified
More Information
SKU AVIARP57452_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57452_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57546
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×