PDXDC1 Antibody - N-terminal region : HRP

PDXDC1 Antibody - N-terminal region : HRP
SKU
AVIARP55147_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PDXDC1 belongs to the group II decarboxylase family. The function of PDXDC1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDXDC1

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 87kDa

Peptide Sequence: Synthetic peptide located within the following region: DEDEEPQSPRIQNIGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Pyridoxal-dependent decarboxylase domain-containing protein 1

Protein Size: 788

Purification: Affinity Purified
More Information
SKU AVIARP55147_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55147_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23042
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×