PELI1 Antibody - N-terminal region : HRP

PELI1 Antibody - N-terminal region : HRP
SKU
AVIARP57429_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PELI1 is an scaffold protein involved in the IL-1 signaling pathway via its interaction with the complex containing IRAK kinases and TRAF6. PELI1 is required for NF-kappa-B activation and IL-8 gene expression in response to IL-1.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PELI1

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: ESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: E3 ubiquitin-protein ligase pellino homolog 1

Protein Size: 418

Purification: Affinity Purified
More Information
SKU AVIARP57429_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57429_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57162
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×