PEPD Antibody - middle region : Biotin

PEPD Antibody - middle region : Biotin
SKU
AVIARP56088_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Xaa-Pro dipeptidase is a cytosolic dipeptidase that hydrolyzes dipeptides with proline or hydroxyproline at the carboxy terminus (but not Pro-Pro). It is important in collagen metabolism because of the high levels of iminoacids.Xaa-Pro dipeptidase is a cytosolic dipeptidase that hydrolyzes dipeptides with proline or hydroxyproline at the carboxy terminus (but not Pro-Pro). It is important in collagen metabolism because of the high levels of iminoacids. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-74 DC395475.1 1-74 75-101 DC385464.1 1-27 102-2018 BC015027.1 1-1917

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PEPD

Key Reference: Surazynski,A., (2008) Int. J. Cancer 122 (6), 1435-1440

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: LGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Xaa-Pro dipeptidase

Protein Size: 493

Purification: Affinity Purified
More Information
SKU AVIARP56088_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56088_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5184
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×