Pepd Antibody - middle region : HRP

Pepd Antibody - middle region : HRP
SKU
AVIARP56087_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Pepd splits dipeptides with a prolyl or hydroxyprolyl residue in the C-terminal position. It plays an important role in collagen metabolism because of the high level of iminoacids in collagen.

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: YSRGGMRHTSYTCICCSGENAAVLHYGHAGAPNDRTIKDGDICLFDMGGE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Xaa-Pro dipeptidase

Protein Size: 493

Purification: Affinity Purified
More Information
SKU AVIARP56087_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56087_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 18624
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×