Pex2 Antibody - C-terminal region : Biotin

Pex2 Antibody - C-terminal region : Biotin
SKU
AVIARP56944_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: QRKSRNQQQVPHPAISGNIWAALRIALSLMDQPELFQAANLGDLDVLLRA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: PEX5-related protein

Protein Size: 615

Purification: Affinity Purified
More Information
SKU AVIARP56944_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56944_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 58869
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×